Protein Info for GFF2709 in Pseudomonas sp. DMC3

Annotation: putative membrane transporter protein YfcA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 80 to 102 (23 residues), see Phobius details amino acids 108 to 128 (21 residues), see Phobius details amino acids 149 to 172 (24 residues), see Phobius details amino acids 184 to 201 (18 residues), see Phobius details amino acids 206 to 223 (18 residues), see Phobius details amino acids 234 to 254 (21 residues), see Phobius details PF01925: TauE" amino acids 15 to 250 (236 residues), 171.7 bits, see alignment E=1.1e-54

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 98% identity to pfl:PFL_3265)

Predicted SEED Role

"Membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (259 amino acids)

>GFF2709 putative membrane transporter protein YfcA (Pseudomonas sp. DMC3)
MPFELSVDLTTLAILAAVAFLAGFIDAIAGGGGLLTTPALLTAGLPPHLVLGTNKLSSTF
GSATASFTFYKRKLFHPRQWTHAIVGTLVGALTGAVVAHYLPAEWLNKMLPVIVFACGLY
LLFGGTPKAPLDSDAPIKKKWQSTQGFSLGFYDGVAGPGTGAFWTVSSLLLYPIDLVKAS
GVARSMNFVSNIAALSVFIFSGQVDWIIGLCMGLSVMVGAFFGARTAISGGAKFIRPVFI
TVVLGLTVRLAWQHWFSVA