Protein Info for GFF2703 in Variovorax sp. SCN45

Annotation: Hydroxymethylpyrimidine ABC transporter, transmembrane component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 transmembrane" amino acids 43 to 65 (23 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 125 to 150 (26 residues), see Phobius details amino acids 157 to 176 (20 residues), see Phobius details amino acids 208 to 233 (26 residues), see Phobius details amino acids 252 to 274 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 105 to 277 (173 residues), 96.7 bits, see alignment E=7.4e-32

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 78% identity to vei:Veis_3506)

Predicted SEED Role

"Hydroxymethylpyrimidine ABC transporter, transmembrane component" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (287 amino acids)

>GFF2703 Hydroxymethylpyrimidine ABC transporter, transmembrane component (Variovorax sp. SCN45)
MNTRSIDTTVPGAPGAIGAPPSADPEYLAWAAARQKRIWRRRVLPALGIVGLILLWWAVI
VVFGVKPFIAPTPWAVLETLYAKRDVLLDNLLPTAFEAAGGFVLGNLAAIVIATIFVHNK
TLQDIFFPVVLMFNAVPLVAKAPVLVLIMGNGVEPKITIAALVCFFPTLVNMVRGLESVN
PQAMELMRVLSASKTEIFFRLRLLNALPYLFSALRIAASMCVIGAVVGEWVGATVGIGAM
ILQATFNFDSPLLYAAIVMSATLSGLFFLLVALAEKLVIRWQPENTQ