Protein Info for GFF2702 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Osmotically inducible lipoprotein B precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 72 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF13441: Gly-zipper_YMGG" amino acids 8 to 71 (64 residues), 44.4 bits, see alignment E=1.3e-15 PF05433: Rick_17kDa_Anti" amino acids 34 to 71 (38 residues), 31.8 bits, see alignment E=1e-11

Best Hits

Swiss-Prot: 100% identical to OSMB_SALTY: Osmotically-inducible lipoprotein B (osmB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K04062, osmotically inducible lipoprotein OsmB (inferred from 96% identity to eum:ECUMN_1586)

Predicted SEED Role

"Osmotically inducible lipoprotein B precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (72 amino acids)

>GFF2702 Osmotically inducible lipoprotein B precursor (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MFMTSKKMAAAVLAITVAMSLSACSNWSKRDRNTAIGAGAGALGGAVLTDGSTLGTLGGA
AVGGVIGHQVGK