Protein Info for PS417_00140 in Pseudomonas simiae WCS417

Annotation: choline-sulfatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 504 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR03417: choline-sulfatase" amino acids 3 to 498 (496 residues), 863.7 bits, see alignment E=2.4e-264 PF00884: Sulfatase" amino acids 4 to 344 (341 residues), 170.2 bits, see alignment E=1.3e-53 PF16347: SGSH_C" amino acids 294 to 429 (136 residues), 48.5 bits, see alignment E=2.2e-16 PF12411: Choline_sulf_C" amino acids 445 to 497 (53 residues), 91.8 bits, see alignment 3.5e-30

Best Hits

KEGG orthology group: K01133, choline-sulfatase [EC: 3.1.6.6] (inferred from 98% identity to pfs:PFLU0027)

Predicted SEED Role

"Choline-sulfatase (EC 3.1.6.6)" in subsystem Choline Transport or Choline and Betaine Uptake and Betaine Biosynthesis (EC 3.1.6.6)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.6.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U2V3 at UniProt or InterPro

Protein Sequence (504 amino acids)

>PS417_00140 choline-sulfatase (Pseudomonas simiae WCS417)
MKRKNILFIMADQMAAPLLPFYGSSPIKLPNLSRLAEQGVVFDAAYCNSPLCAPSRFTLV
SGQLPSKIGAYDNAADFPADVPTYAHYLRRLGYRTALSGKMHFCGPDQLHGYEERLTSDI
YPADYGWAVNWDEPDVRPTWYHNMSSVLQAGPCVRTNQLDFDEEVVFKAQQYLFDHIRED
GDQPFCLTVSMTHPHDPYTIPKPFWDLYDNADIPLPTTPAQGDLDPHSQRLLKVYGLWDK
PLPVDKIRDARRAYFGACSYIDSNVGKLLQTLEDTGLADDTIIVFSGDHGDMLGERGLWY
KMHWFEMAARVPLLVSAPGQFAAGRVSKAVSTADLLPTLVELAGGELDPRLPLDGRSLVP
HLQGQGGHDEVFGEYMAEGTISPLMMIRRGAYKFIYSEDDPCLLFDVHNDPREQEDLSQS
PHHQALFAAFLDEARAKWDIPAIHQQVLASQRRRRLVFEALTQGKLKSWDHQPLVDASQQ
YMRNHIDLDALERKARYPQPCQNQ