Protein Info for GFF2693 in Sphingobium sp. HT1-2

Annotation: Probable NreB protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 44 to 69 (26 residues), see Phobius details amino acids 76 to 95 (20 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 143 to 187 (45 residues), see Phobius details amino acids 219 to 241 (23 residues), see Phobius details amino acids 253 to 271 (19 residues), see Phobius details amino acids 283 to 305 (23 residues), see Phobius details amino acids 311 to 328 (18 residues), see Phobius details amino acids 349 to 368 (20 residues), see Phobius details amino acids 380 to 399 (20 residues), see Phobius details PF05977: MFS_3" amino acids 3 to 301 (299 residues), 66.8 bits, see alignment E=1.4e-22 PF07690: MFS_1" amino acids 13 to 298 (286 residues), 89.4 bits, see alignment E=2.3e-29 amino acids 221 to 406 (186 residues), 53.1 bits, see alignment E=2.5e-18

Best Hits

KEGG orthology group: None (inferred from 62% identity to pag:PLES_26221)

Predicted SEED Role

"Probable NreB protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (445 amino acids)

>GFF2693 Probable NreB protein (Sphingobium sp. HT1-2)
MLSVLSNRTYRHLFLAQVVALVGTGLATVALGLLAYDIAGGSAGAVLGTALAIKMIAYIG
VAPVVGAFADRLPRRAFLVTMDVLRAAVAICLPFVSEIWQIYVLIFVLQSASAAFTPTFQ
ATIPDVLPEERDYTKALALSRLAYDMESLTSPMLAAALLTVINFHWLFSGTAVGFVGSAI
LVLSTTLPRALNRKEVRTGIYAKTTRGMRIYLKTPRLRGLLALTFASAAASSMVIVNTVV
IVRDQLGLGQRDVAFTLAAFGGGSILAALGLPRILDRISDRSIMITAAAVLAWGLAIMGA
LTHWFGSSSNYWSILLAGWFVLGMAYSMSVTPSGRLLKRSANAEDRPALFAAQFALSHGS
WLICYPLAGQLGARENQVMTFIAMSIIAHFGVIAAYLLWPSADPDELPHDHVDLDADHPH
LRDKHGQSAGHAYVIDDLHQHWPRS