Protein Info for GFF2689 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Glycine betaine transporter OpuD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 504 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 41 to 60 (20 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details amino acids 178 to 200 (23 residues), see Phobius details amino acids 220 to 238 (19 residues), see Phobius details amino acids 250 to 274 (25 residues), see Phobius details amino acids 301 to 322 (22 residues), see Phobius details amino acids 334 to 356 (23 residues), see Phobius details amino acids 390 to 416 (27 residues), see Phobius details amino acids 433 to 452 (20 residues), see Phobius details amino acids 458 to 481 (24 residues), see Phobius details PF02028: BCCT" amino acids 4 to 484 (481 residues), 626.2 bits, see alignment E=1.7e-192 TIGR00842: transporter, betaine/carnitine/choline transporter (BCCT) family" amino acids 40 to 484 (445 residues), 515 bits, see alignment E=8.5e-159

Best Hits

KEGG orthology group: K05020, glycine betaine transporter (inferred from 74% identity to har:HEAR2553)

Predicted SEED Role

"Glycine betaine transporter OpuD" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (504 amino acids)

>GFF2689 Glycine betaine transporter OpuD (Hydrogenophaga sp. GW460-11-11-14-LB1)
MQLIVSAGLILAIVLWGVVAPDALDAVFEGALAVITRDFGWLYLWVVLGLVVFALVLAFS
RYGDLKLGGEDDEPEFSIGSWFSMLFAAGMGIGLVFWGVAEPISHYGTPPPGIVARTPEA
ANAAMRYSFFHWGLHPWAVYSIVALSIAFFQFRKGGTALVSTAVQALPWAPLQRLGPVVN
VLAVIATAFGVAASLGMGALQINSGLHALLGLPVGEVQQVGIIVVTTVLFLVSAVSGVTK
GIKWLSNINLVLAALLALVVFVVGPTVVIIDAFTSTLGSYVSELVRMSLRMTPFRDSTWV
GGWTIFYWAWWVSWSPFVGLFIARVSRGRTIREFVLGTMLAPSLAAFVWFSVFGGTALHL
EIMQGVPVADAVRADVSTALFAMFKALPMTALMSGVATVLVLLFFVTSGDSATLVLGMMS
TGGEENPSARVKIAWGLLISGIAISLLLAGGLKAVQTATIVFALPFAVVIVLMAIALWRG
VRDDWDEEQRRERALRRRMREVLK