Protein Info for GFF2688 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Peptide transport periplasmic protein SapA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 511 PF00496: SBP_bac_5" amino acids 43 to 422 (380 residues), 288.1 bits, see alignment E=5.4e-90

Best Hits

Swiss-Prot: 100% identical to SAPA_SALTY: Peptide transport periplasmic protein SapA (sapA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02035, peptide/nickel transport system substrate-binding protein (inferred from 99% identity to stt:t1597)

MetaCyc: 37% identical to dipeptide ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (511 amino acids)

>GFF2688 Peptide transport periplasmic protein SapA (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VYCVSGQVNTFNPQKASSGLIVDTLAAQLYDRLLDVDPYTYRLVPELAESWEVLDNGATY
RFHLRRDVSFQKTAWFTPTRKLNADDVVFTFQRIFDRRHPWHNINGSSFPYFDSLQFADN
VKSVRKLDNNTVEFRLTQPDASFLWHLATHYASVMSAEYAAQLSRKDRQELLDRQPVGTG
PFQLSEYRAGQFIRLQRHDGFWRGKPLMPQVVVDLGSGGTGRLSKLLTGECDVLAWPAAS
QLTILRDDPRLRLTLRPGMNIAYLAFNTDKPPLNNPAVRHALALSINNQRLMQSIYYGTA
ETAASILPRASWAYDNDAKITEYNPQKSREQLKALGIENLTLHLWVPTSSQAWNPSPLKT
AELIQADMAQVGVKVVIVPVEGRFQEARLMDMNHDLTLSGWATDSNDPDSFFRPLLSCAA
INSQTNFAHWCNPEFDSVLRKALSSQQLASRIEAYEEAQNILEKELPILPLASSLRLQAY
RYDIKGLVLSPFGNASFAGVSREKHEEVKKP