Protein Info for GFF2687 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Psp operon transcriptional activator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 TIGR02974: psp operon transcriptional activator" amino acids 13 to 329 (317 residues), 529.2 bits, see alignment E=2.2e-163 PF14532: Sigma54_activ_2" amino acids 14 to 184 (171 residues), 63.7 bits, see alignment E=5.9e-21 PF00158: Sigma54_activat" amino acids 14 to 175 (162 residues), 210 bits, see alignment E=4.9e-66 PF07728: AAA_5" amino acids 36 to 154 (119 residues), 30.8 bits, see alignment E=6.8e-11 PF25601: AAA_lid_14" amino acids 185 to 247 (63 residues), 62.1 bits, see alignment E=9.1e-21

Best Hits

Swiss-Prot: 86% identical to PSPF_ECOLI: Psp operon transcriptional activator (pspF) from Escherichia coli (strain K12)

KEGG orthology group: K03974, psp operon transcriptional activator (inferred from 98% identity to sea:SeAg_B1459)

Predicted SEED Role

"Psp operon transcriptional activator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (331 amino acids)

>GFF2687 Psp operon transcriptional activator (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VAIFIMAEFKDNLLGEANRFLEVLEQVSRLAPLDKPVLIIGERGTGKELIANRLHYLSSR
WQGPLISLNCAALNENLLDSELFGHEAGAFTGAQKRHPGRFERADGGTLFLDELATAPML
VQEKLLRVIEYGELERVGGSQPLQVNVRLVCATNADLPAMVKEGTFRADLLDRLAFDVVQ
LPPLRERQSDIMLMAEHFAIQMCRELRLPLFPGFTDRAKETLLHYAWPGNVRELKNVVER
SVYRHGSSEQPLDEIVIDPFQRHPAEPPAPALPAASVTPDLPLKLREFQLQQEKALLQRS
LQQAKFNQKRAADLLALTYHQFRALLKKHQL