Protein Info for GFF2684 in Xanthobacter sp. DMC5

Annotation: CDP-paratose 2-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 PF02719: Polysacc_synt_2" amino acids 27 to 160 (134 residues), 28.4 bits, see alignment E=3.9e-10 PF04321: RmlD_sub_bind" amino acids 27 to 252 (226 residues), 38.5 bits, see alignment E=3e-13 PF01370: Epimerase" amino acids 27 to 288 (262 residues), 174.6 bits, see alignment E=9.9e-55 PF00106: adh_short" amino acids 27 to 99 (73 residues), 25.4 bits, see alignment E=3.8e-09 PF08659: KR" amino acids 27 to 152 (126 residues), 23.8 bits, see alignment E=1.5e-08 PF01073: 3Beta_HSD" amino acids 28 to 277 (250 residues), 67.6 bits, see alignment E=3.7e-22 PF16363: GDP_Man_Dehyd" amino acids 28 to 156 (129 residues), 89.8 bits, see alignment E=9.6e-29 amino acids 176 to 338 (163 residues), 55.6 bits, see alignment E=2.4e-18 PF07993: NAD_binding_4" amino acids 29 to 263 (235 residues), 52.2 bits, see alignment E=2e-17

Best Hits

KEGG orthology group: K12454, CDP-paratose 2-epimerase [EC: 5.1.3.10] (inferred from 69% identity to mno:Mnod_0433)

Predicted SEED Role

"Nucleoside-diphosphate-sugar epimerases"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (374 amino acids)

>GFF2684 CDP-paratose 2-epimerase (Xanthobacter sp. DMC5)
MTAPQRPDMAIPSARPAKPSLSGSRPVLVTGGAGFIGANLADRLAREGEDVLLFDALARP
GVERNVTWLKARHPRRISFAKADVRDAGALTEAAQGARAVFHFAAQVAVTTSLADPSADF
AVNAGGTLALLEALRRHAPQTPLIFASTNKVYGDLSGLGVSLAGDAWAPDAAQVRRFGIG
EDQPLDFHTPYGCSKGAAEQYVLDYARSFGLPTCVMRMSCIYGPRQMGTEDQGWVAHFLL
RLMAGEPITIFGDGRQVRDVLFVEDAVEAYVRAWRRIGAVSGRAFNLGGGPANAVSLLAV
IARAEEMLGTKADLVFQPWRPGDQRYYVSDTRRVAAGLDLPAPLVWREGLRRLAGWLQEE
GVAMAAPASQAVGA