Protein Info for GFF2681 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Sulfate permease family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 556 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 43 to 68 (26 residues), see Phobius details amino acids 75 to 94 (20 residues), see Phobius details amino acids 100 to 123 (24 residues), see Phobius details amino acids 135 to 158 (24 residues), see Phobius details amino acids 170 to 188 (19 residues), see Phobius details amino acids 195 to 217 (23 residues), see Phobius details amino acids 238 to 259 (22 residues), see Phobius details amino acids 316 to 336 (21 residues), see Phobius details amino acids 342 to 359 (18 residues), see Phobius details amino acids 371 to 387 (17 residues), see Phobius details amino acids 393 to 412 (20 residues), see Phobius details PF00916: Sulfate_transp" amino acids 22 to 379 (358 residues), 262.4 bits, see alignment E=5.7e-82 PF01740: STAS" amino acids 442 to 541 (100 residues), 42.2 bits, see alignment E=6.2e-15

Best Hits

KEGG orthology group: None (inferred from 64% identity to adn:Alide_2548)

Predicted SEED Role

"Sulfate permease family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (556 amino acids)

>GFF2681 Sulfate permease family protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSTRLQHLFPFLRWPRPDAALLRGEAMAGLTVGLMVIPQGVAYAALAGMPLVTGIYASLL
PALIAVLFSASPRLAVGPTALTCLLVGASLSGLAEPGSAQWVALAVWLALLTGLLQIALG
FARFGWLLNLVNSPVLMAFTQAAAVLIIASQLPALLGFAAWDTLLTQPRVHWPALLFGVG
SLALLVLARRWRPGFPTVLTVVVASAAISYAVGFEAQGGAVIGALPQGLPMPYWPSWPGW
ATLGQLVVPTLVITLVSFLETASSAKVDNGQRGQRWDQDQDLIGQGLAKLASGLSGAFPT
SSSFSRSALNLYAGAKTGWATIFSVIVVLIALLLFIPMLHHVPLAVLASIVLVAVIGLIK
PRAFTQLWKLSRVETAIAGITFAVTLLAAPRLYWGVLAGVLMALSHFLYLRLHPRIIEVG
LHPDGSLRDRHLWKLRPLAPHLYALRMDAALDFATANGFERAVSEHIAAHPDTRHVMLIA
HPINWIDATGAEAFGRLRAQLDDQHIELHLVGIKLPVENVLRLAGHLEAGPRLHLYRTEA
EGLRAASDLIPEDPSI