Protein Info for PS417_13670 in Pseudomonas simiae WCS417

Annotation: protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 659 PF01136: Peptidase_U32" amino acids 79 to 304 (226 residues), 239 bits, see alignment E=4.5e-75 PF12392: DUF3656" amino acids 399 to 512 (114 residues), 65.2 bits, see alignment E=8.6e-22

Best Hits

Swiss-Prot: 70% identical to RLHA_ECOLI: 23S rRNA 5-hydroxycytidine C2501 synthase (rlhA) from Escherichia coli (strain K12)

KEGG orthology group: K08303, putative protease [EC: 3.4.-.-] (inferred from 98% identity to pfs:PFLU3110)

MetaCyc: 70% identical to 23S rRNA 5-hydroxycytidine C2501 synthase (Escherichia coli K-12 substr. MG1655)
RXN-21990

Predicted SEED Role

"Putative collagenase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U9R7 at UniProt or InterPro

Protein Sequence (659 amino acids)

>PS417_13670 protease (Pseudomonas simiae WCS417)
MSLPKHHLELLSPARDVAIAREAILHGADAVYIGGPSFGARHNACNDVSDIASLVEFARR
YHARVFTTINTILHDNELEPARKLIHQLYDAGVDALIVQDLGVMELDIPPIELHASTQTD
IRTLGRAKFLDQAGFSQLVLARELNLQEIRAIADETDAAIEFFIHGALCVAFSGQCNISH
AQNGRSANRGDCSQACRLPYTLKDDQGRVVAFEKHLLSMKDNNQSANLRALVEAGVRSFK
IEGRYKDMGYVKNITAYYRQRLDEILEDRPDLARASSGRTAHFFLPDPEKTFHRGSTDYF
VTDRKIDIGAFDTPTFTGLPVGVVEKAGKRDLQVVTHEPLSNGDGLNVLVKREVVGFRAN
IAEPKGEFEEDGEKRYRYRVEPNEMPAGLHQLRPNHPLNRNLDHNWQQALLKTSSERRIG
LTWVARLREEHLDVTATSEEGISASVTLPGPFGVANKPEQALDTLRDLLGQLGTTEYHAT
DIQLDAPQAFFIPNSQLKALRREVIEALTAARVAAHPRGGRKAETTPPPVYPDAHLSFLA
NVYNQKARDFYHRHGVKLIDAAFEAHEETGEVPVMITKHCLRFSFNLCPKQAKGVTGVKT
KVAPMQLIHGDEVLTLKFDCKPCEMHVVGKIKGHILGLPQPGSAVEHFNPENIIFQGTH