Protein Info for PS417_13615 in Pseudomonas simiae WCS417

Annotation: long-chain acyl-CoA synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 492 transmembrane" amino acids 183 to 205 (23 residues), see Phobius details amino acids 238 to 255 (18 residues), see Phobius details PF00501: AMP-binding" amino acids 15 to 339 (325 residues), 155.9 bits, see alignment E=1.4e-49 PF23562: AMP-binding_C_3" amino acids 376 to 481 (106 residues), 22.7 bits, see alignment E=1.1e-08

Best Hits

KEGG orthology group: None (inferred from 89% identity to pfs:PFLU3122)

Predicted SEED Role

"O-succinylbenzoic acid--CoA ligase (EC 6.2.1.26)" in subsystem Menaquinone and Phylloquinone Biosynthesis (EC 6.2.1.26)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.2.1.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U9Q7 at UniProt or InterPro

Protein Sequence (492 amino acids)

>PS417_13615 long-chain acyl-CoA synthetase (Pseudomonas simiae WCS417)
MSPETRRFHAVLRGHAERNDGAIALWGDTWKMDYTSLFAEVAYRQERLRDEGVKVVALAL
DNGVDAMLWDLAVLFEGLTCLTLPPFFSPAQRAHCLEQSHAERVIAEPHLAAELQAGGYR
QAGEFWCRTFEGRPAMPSNTAKLTFTSGTTGAPKGVCLSADSLLRVTRELHQASHSRDPR
HHLALLPIAILLENLGCYAALYAGATLSLPSQKSLGIQGASAVDAAQLLGCLATRQPHSL
ILVPQLLLMLVIAAEQKAFNPKSLRFAAVGGARVSKALLQRAQQLGMTVYEGYGLSECAS
VVCLNHPEAHRPGSVGRPLPHVEIRLAEDGEVLVKGPMLLGYLDQPDLHAPWWPTGDLGD
VDEDGFLYLKGRKKHQFVTSYGRNVNPDWVEAELTQGGIIAQAFVYGEALPENHALLWPL
RADCSAAQLAAAVAEANTGLPDYAQVHRWTRLAEPFTTANGLLTANGRPKRDAIVARYQS
DLTPELNEESSS