Protein Info for GFF2667 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Right origin-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 PF12833: HTH_18" amino acids 29 to 104 (76 residues), 73.1 bits, see alignment E=3.7e-24 PF00165: HTH_AraC" amino acids 66 to 104 (39 residues), 29 bits, see alignment 1.8e-10 PF06445: GyrI-like" amino acids 126 to 282 (157 residues), 84.8 bits, see alignment E=1.6e-27 PF14526: Cass2" amino acids 211 to 282 (72 residues), 28.3 bits, see alignment E=3.8e-10

Best Hits

KEGG orthology group: None (inferred from 99% identity to sed:SeD_A1661)

Predicted SEED Role

"Right origin-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (283 amino acids)

>GFF2667 Right origin-binding protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKKAIIISVLEQIEKNLEERIDIEKLVVITGYSRRSLQDFFKEKCGVSIGKYIRQRKLSR
SATLLKLTSQSVTDIAFRMGFDSVQSYSREFKKTFGVNPNNYRKADFWDLRNLRPPYWLD
CDEHYQFEICQLTSKEIFGFQTSHQIATNDLPKKASPIKWKIIHETLRTWGENVYCLSSF
KPDNTKDQVIAVSSFFGMEHNSVDGGKIPMSRVIKCGKYAKFHFVGHKEQYQQFSNTIYM
CILPKLNLIRREGEDIEYFHLASVQKQQNNESIVDLYYYIPVL