Protein Info for GFF2663 in Variovorax sp. SCN45

Annotation: FIG022979: MoxR-like ATPases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 PF20030: bpMoxR" amino acids 6 to 188 (183 residues), 30.5 bits, see alignment E=6.6e-11 PF07726: AAA_3" amino acids 37 to 167 (131 residues), 204.4 bits, see alignment E=1.9e-64 PF07728: AAA_5" amino acids 43 to 165 (123 residues), 51.5 bits, see alignment E=3.9e-17 PF00004: AAA" amino acids 43 to 154 (112 residues), 30.9 bits, see alignment E=1.2e-10 PF17863: AAA_lid_2" amino acids 237 to 285 (49 residues), 52 bits, see alignment 1.8e-17

Best Hits

Swiss-Prot: 46% identical to YEAC_BACSU: Uncharacterized protein YeaC (yeaC) from Bacillus subtilis (strain 168)

KEGG orthology group: K03924, MoxR-like ATPase [EC: 3.6.3.-] (inferred from 97% identity to vpe:Varpa_2243)

Predicted SEED Role

"FIG022979: MoxR-like ATPases"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>GFF2663 FIG022979: MoxR-like ATPases (Variovorax sp. SCN45)
MDVAAKLATLLSQLNTVIVGKEAQVRDCVACLLAGGHLLIEDVPGVGKTTLAHALSHTFG
LQFSRVQFTADLMPGDLSGVAIYDRGQQAFVFHPGPIFAQVLLADEINRASPKTQSALLE
AMEEKQVTVEGETRPLPSPFFVIATQNPQDQLGTFALPESQLDRFLMRISLGYPDRAAER
QLLAGADRREMLASLPAMLTAGELTAIQQRVQQVHASDALLNYVQDLIAATRSGRWFLQG
LSPRAGIAVLRAAKAQALLANRNYVAPDDVQAVLPQTIAHRLTPVGDAGRGAVEQVRAMI
AAVPLP