Protein Info for GFF2663 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Magnesium and cobalt efflux protein CorC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 61 to 86 (26 residues), see Phobius details amino acids 97 to 119 (23 residues), see Phobius details amino acids 139 to 160 (22 residues), see Phobius details PF01595: CNNM" amino acids 5 to 196 (192 residues), 157.1 bits, see alignment E=5.8e-50 PF00571: CBS" amino acids 282 to 331 (50 residues), 33.9 bits, see alignment 5e-12 PF03471: CorC_HlyC" amino acids 346 to 425 (80 residues), 67.9 bits, see alignment E=9.4e-23

Best Hits

Swiss-Prot: 44% identical to Y260_SYNY3: UPF0053 protein sll0260 (sll0260) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K03699, putative hemolysin (inferred from 82% identity to lch:Lcho_3640)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (438 amino acids)

>GFF2663 Magnesium and cobalt efflux protein CorC (Hydrogenophaga sp. GW460-11-11-14-LB1)
MEIALLFALILLNGVFAMSEIALVTARKVRLQKLIDEGDGAAAAAVKLGEDPTRFLSTIQ
IGITSIGVLNGIVGEAALAAPLALWLAELGVPAPYSTYGATGLVVVLITYFSIVVGELVP
KRLGQSHPETLARLVARPIDWLAVATKPFVLLLSVSTRALMKVLGIKENGASAVTEEEIH
AMLAEGTTAGVIESHEHTMVRNVFRLDDRQIGSLMVPRGDVVTLDLDQPFEVNMARVDAS
DHARFPVVRGSLGNVVGVVNARQWLSQALRGAQRELESQPLQPPLYVPETLTGMELLDNF
RQSDVHMAFVIDEYGEVQGIVTLQDLIEAITGEFSPRDPETSWAMQREDGSWLLDGHIPV
PELKDRLDLGSVPDEERGRYHTLSGMMMLLTGRMPRVADSVSWEGWRLEIVDMDGRTIDK
VLATREAQDDAAPAVALS