Protein Info for PS417_13565 in Pseudomonas simiae WCS417

Annotation: permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 39 to 60 (22 residues), see Phobius details amino acids 72 to 89 (18 residues), see Phobius details amino acids 100 to 117 (18 residues), see Phobius details amino acids 126 to 144 (19 residues), see Phobius details amino acids 150 to 168 (19 residues), see Phobius details amino acids 180 to 199 (20 residues), see Phobius details amino acids 206 to 227 (22 residues), see Phobius details amino acids 236 to 256 (21 residues), see Phobius details amino acids 262 to 281 (20 residues), see Phobius details PF00892: EamA" amino acids 9 to 138 (130 residues), 57.5 bits, see alignment E=8.7e-20 amino acids 149 to 274 (126 residues), 35.3 bits, see alignment E=6.1e-13

Best Hits

KEGG orthology group: None (inferred from 38% identity to ara:Arad_4694)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TZF5 at UniProt or InterPro

Protein Sequence (332 amino acids)

>PS417_13565 permease (Pseudomonas simiae WCS417)
MTQDRGLQGIALCSLAYLFLALQDAVVKWLVADYSVFTILFWRSLVVVIVCLVAGRMGLL
RRAWVSVSRRMLIIRGLLSLLAWLLYYTAAKDLSLAEMTTLYFSAPIMVTLLAALILKER
ASRGQWIALIIGFVGVIIACRPTHMLDPWPIALTLGAALCWAFTYIQLRQVDPSSTVLEQ
MLITNVVFVVCMGVTLPWTHTPAPAPAWLGMLAAGLVGGIGQFLLFASFRRATATLLAPF
EYTGLIWAFILSSLVWGTLMDGSLIIGAVLIAISGTLAMLSARHPVSQDVVGAECAVTQP
LYPAAADVQPVGGAEGAGVEAPLEPESVEHRR