Protein Info for PS417_13540 in Pseudomonas simiae WCS417

Annotation: sodium:proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 30 to 52 (23 residues), see Phobius details amino acids 64 to 82 (19 residues), see Phobius details amino acids 89 to 115 (27 residues), see Phobius details amino acids 119 to 139 (21 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details amino acids 191 to 210 (20 residues), see Phobius details amino acids 234 to 263 (30 residues), see Phobius details amino acids 326 to 346 (21 residues), see Phobius details amino acids 352 to 372 (21 residues), see Phobius details amino acids 383 to 401 (19 residues), see Phobius details amino acids 413 to 433 (21 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 16 to 272 (257 residues), 84.5 bits, see alignment E=3.6e-28 amino acids 339 to 439 (101 residues), 31.4 bits, see alignment E=4.8e-12

Best Hits

KEGG orthology group: None (inferred from 95% identity to pfs:PFLU3131)

Predicted SEED Role

"sodium/hydrogen exchanger family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TXK4 at UniProt or InterPro

Protein Sequence (450 amino acids)

>PS417_13540 sodium:proton antiporter (Pseudomonas simiae WCS417)
MTFILWMAVLGAVLLTLALTSSYLRWMPVTTSAVCLLLGVGIGPLGVDLLHLDIKHSARW
MEHLTEVAVLFSLFVSGLKLRLPLKHRTWRIAFGMAGPVMLLTILGISLALHYLFTLSWG
VSLLVGAILAPTDPVLAGLVQVNNAQDYDALRFGLSGEAGLNDGTAFPFVIFALLFMQHG
GFDGDWLGGWVLKNLLWAVPAGLLIGYWMGRGIGRVTLWLRITNSDSTLSPNDYLTLALI
ALAYVVAEAVGGYGFLSVFAAGLGLRQAEFRSTGNSQTPSEHLALPVVGHLEVEPDRALQ
GDVSELKDTQIAAGVMMGDMLSFGSLVERSMEVFLVTVLGIVLISHWDWRALPMAALLFG
VIRPISVLAMPWGRLIDRQQRGLMGWFGIRGIGSIYYLFYALNHGLIGTSSAVAVNLTLS
VIALSIVVHGLSTQPMLVWYERRARVNTQS