Protein Info for GFF2656 in Variovorax sp. SCN45

Annotation: Acyltransferase 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 transmembrane" amino acids 68 to 86 (19 residues), see Phobius details amino acids 107 to 128 (22 residues), see Phobius details amino acids 162 to 185 (24 residues), see Phobius details amino acids 199 to 221 (23 residues), see Phobius details amino acids 228 to 245 (18 residues), see Phobius details amino acids 252 to 270 (19 residues), see Phobius details amino acids 276 to 294 (19 residues), see Phobius details amino acids 314 to 334 (21 residues), see Phobius details amino acids 341 to 364 (24 residues), see Phobius details amino acids 371 to 390 (20 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 25 to 357 (333 residues), 87.1 bits, see alignment E=6.3e-29

Best Hits

KEGG orthology group: None (inferred from 77% identity to vap:Vapar_3370)

Predicted SEED Role

"Acyltransferase 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (391 amino acids)

>GFF2656 Acyltransferase 3 (Variovorax sp. SCN45)
LTAVANGAAPVDRALSPSVGRMPLLDAAKGIACAVIVGHHLSRYGPMPAGAYALAPDFFA
WLSNEGRLAVQVFLVIAGFLAAASLAPDGMLRVDRPVTRILQRYGRLVMPYLAALTVCVL
VAAVVRPWLDEEVVPAAPTFGQLVAHGLLLQDLLGYESLSTGVWYVAIDFQLFALALALV
GLPTMLQRSTGAAPASLPARWLPVALVLGLAVASLVLFNRNAGLDDTAFYFFGTYGLGML
VFWIGRATRFSTWQSAVALLALLGAGALAIDWRSRIATALVTALLLAIAQRRHWLSPAHW
PLLAVPLQRLGRMSYSLFLIHFPVLLAMNAAVANAGPHGAWFDAAGLVATFALSVAAAAL
LYRWVEARPASWRGVFMLFAALLVSGIVVSH