Protein Info for GFF2655 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Methylated-DNA--protein-cysteine methyltransferase (EC 2.1.1.63)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 PF02870: Methyltransf_1N" amino acids 6 to 78 (73 residues), 38.2 bits, see alignment E=1.7e-13 TIGR00589: methylated-DNA--[protein]-cysteine S-methyltransferase" amino acids 87 to 166 (80 residues), 128.6 bits, see alignment E=3.6e-42 PF01035: DNA_binding_1" amino acids 88 to 167 (80 residues), 128 bits, see alignment E=9.7e-42

Best Hits

Swiss-Prot: 100% identical to OGT_SALTI: Methylated-DNA--protein-cysteine methyltransferase (ogt) from Salmonella typhi

KEGG orthology group: K00567, methylated-DNA-[protein]-cysteine S-methyltransferase [EC: 2.1.1.63] (inferred from 99% identity to sew:SeSA_A1784)

MetaCyc: 88% identical to methylated-DNA--[protein]-cysteine S-methyltransferase (Escherichia coli K-12 substr. MG1655)
Methylated-DNA--[protein]-cysteine S-methyltransferase. [EC: 2.1.1.63]; 2.1.1.63 [EC: 2.1.1.63]

Predicted SEED Role

"Methylated-DNA--protein-cysteine methyltransferase (EC 2.1.1.63)" in subsystem DNA repair, bacterial (EC 2.1.1.63)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.63

Use Curated BLAST to search for 2.1.1.63

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (171 amino acids)

>GFF2655 Methylated-DNA--protein-cysteine methyltransferase (EC 2.1.1.63) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MLRLLEEKIATPLGPLWVVCDEQFRLRAIEWEQYRDRMEQLLNIHYRHEGYERVSATNPG
GLSDKLADYFAGNLAVIDTLETATGGTPFQREVWQALRAIPCGQVMHYGQLAAQLGRPGA
ARAVGAANGANPISIVVPCHRVIGRNGTLTGYAGGVQRKEWLLRHEGYLLL