Protein Info for GFF2654 in Methylophilus sp. DMC18

Annotation: Thiosulfate sulfurtransferase GlpE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 47 to 68 (22 residues), see Phobius details amino acids 132 to 154 (23 residues), see Phobius details amino acids 174 to 192 (19 residues), see Phobius details PF09335: VTT_dom" amino acids 29 to 153 (125 residues), 51.2 bits, see alignment E=1.7e-17 PF00581: Rhodanese" amino acids 208 to 300 (93 residues), 44.2 bits, see alignment E=2.2e-15

Best Hits

KEGG orthology group: None (inferred from 89% identity to rcu:RCOM_1959910)

Predicted SEED Role

"Alkaline phosphatase like protein" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>GFF2654 Thiosulfate sulfurtransferase GlpE (Methylophilus sp. DMC18)
MNVVLELIQQYGLLIVFASVFLEQMGLPLPAYPTLLLAGVLIGNGQYSWAAMLLVALVAA
LLADSIWYRAGRKYGKRVMGKLCKISLSPDTCVRQTEALYLKFGPPALLVCKFIPGFASI
SSALAGSSGTPYWLFALMDGLGALLWSGSALWLGNLFSSAIDELMLTLVEMGKWGTGLVL
LLLTAFIAVKWWDRQRFLKSLRMARISVQELHTLIASDAAPVILDTRAPHLIEDGWIPGA
QFVTLEDVDQLTLDIDEDAPVILYCSCPNEVTAAKVAKKLIRRGYRNIRPLSGGIDAWRD
AGFAITAAKDAHV