Protein Info for GFF2653 in Variovorax sp. SCN45

Annotation: Cytochrome d ubiquinol oxidase subunit I (EC 1.10.3.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 537 transmembrane" amino acids 18 to 43 (26 residues), see Phobius details amino acids 55 to 76 (22 residues), see Phobius details amino acids 94 to 117 (24 residues), see Phobius details amino acids 128 to 148 (21 residues), see Phobius details amino acids 188 to 209 (22 residues), see Phobius details amino acids 221 to 239 (19 residues), see Phobius details amino acids 392 to 415 (24 residues), see Phobius details amino acids 426 to 448 (23 residues), see Phobius details amino acids 473 to 493 (21 residues), see Phobius details PF01654: Cyt_bd_oxida_I" amino acids 8 to 506 (499 residues), 583.1 bits, see alignment E=1.3e-179

Best Hits

Swiss-Prot: 60% identical to CYDA_ECOLI: Cytochrome bd-I ubiquinol oxidase subunit 1 (cydA) from Escherichia coli (strain K12)

KEGG orthology group: K00425, cytochrome bd-I oxidase subunit I [EC: 1.10.3.-] (inferred from 90% identity to vap:Vapar_3367)

MetaCyc: 60% identical to cytochrome bd-I subunit 1 (Escherichia coli K-12 substr. MG1655)
RXN0-5266 [EC: 7.1.1.7]; 1.11.1.- [EC: 7.1.1.7]; 1.11.1.- [EC: 7.1.1.7]

Predicted SEED Role

"Cytochrome d ubiquinol oxidase subunit I (EC 1.10.3.-)" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (537 amino acids)

>GFF2653 Cytochrome d ubiquinol oxidase subunit I (EC 1.10.3.-) (Variovorax sp. SCN45)
MDLDIVALSRLQFAVTALYHFLFVPLTLGLSIIIAIMETVYVMTGRVIWRDMTKFWGVLF
GINFAMGVATGIVMEFQFGMNWSYYSHYVGDIFGAPLAIEGLMAFFMEATFVGLFFFGWD
KLSKVGHLIATWAVAIGSNFSALWILIANGWMQNPVGAAFNPQTMRMEVTDFAAVLTNPV
AQAKFVHTVSAGYVCAAVFVLGVSAWYLLKGRHLELAKRSMTVAASFGLAAALSVAVLGD
ESGYLSGEHQKMKLAAIEAMWETQPAPAAFTVIGFPDQEARETHYAIHIPGVMGLIGTRS
LDTVMPGIDELVKRAEVRIREGLKAYDALQKIREAGGTGKVTQGVRGDFEDNGINMGYAL
LLKRYVDDPRQATDEQITKAAWDTVPQVAPLFWLFRVMVGIGVLLIVLTATFFVLSARRK
LDSYRWLLKVAVFAIPLPWIAIESGWLVAEFGRQPWVIEGVLPTAVAVSNLGVKTLLLTI
AGFIAIYTTLLIIEMKLMLKAIRKGPEAEHAPDEGDTLSHIPPAHAGATIARTGSAA