Protein Info for GFF2653 in Pseudomonas sp. DMC3

Annotation: Cobalt/magnesium transport protein CorA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 transmembrane" amino acids 266 to 285 (20 residues), see Phobius details amino acids 297 to 317 (21 residues), see Phobius details PF01544: CorA" amino acids 33 to 319 (287 residues), 184.2 bits, see alignment E=1.8e-58

Best Hits

KEGG orthology group: K03284, metal ion transporter, MIT family (inferred from 95% identity to pfo:Pfl01_1742)

Predicted SEED Role

"Magnesium and cobalt transport protein CorA" in subsystem Campylobacter Iron Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (323 amino acids)

>GFF2653 Cobalt/magnesium transport protein CorA (Pseudomonas sp. DMC3)
MGRVVAAAVYSEGKKVTNIALDEGAAWAAKPGHFVWIGLEEPDAQELSNLQRQFNLHELA
IEDALEKHSRPKLETFGDALFIVTYSPVRENGVLQFIETHIFAGRGYIITARNGHSASYA
YVRQRCEARPLLLEHGEDFVLYALLDFVIENYQPVGEAIHAEIDELERNVLCSALNERDI
QKLHGLRRDVVRLRRYAAPMVEIGEELQKLSFPFIDKNMRPYFRDVQIHVTRQMEDLSTL
ADIASQTIEIGVLLEASRQSVVQRKFAAWAAILAFPTAVAGIYGMNFQNMPELTWHYGYF
AVLGFITVGCVSLWASFKRSGWL