Protein Info for GFF2653 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Na(+) H(+) antiporter subunit G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 133 transmembrane" amino acids 13 to 35 (23 residues), see Phobius details amino acids 47 to 67 (21 residues), see Phobius details amino acids 73 to 95 (23 residues), see Phobius details PF03334: PhaG_MnhG_YufB" amino acids 18 to 97 (80 residues), 64 bits, see alignment E=6e-22 TIGR01300: monovalent cation/proton antiporter, MnhG/PhaG subunit" amino acids 18 to 99 (82 residues), 63.8 bits, see alignment E=7.4e-22

Best Hits

KEGG orthology group: K05564, multicomponent K+:H+ antiporter subunit G (inferred from 60% identity to pba:PSEBR_a3338)

Predicted SEED Role

"Na(+) H(+) antiporter subunit G" in subsystem Sodium Hydrogen Antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (133 amino acids)

>GFF2653 Na(+) H(+) antiporter subunit G (Hydrogenophaga sp. GW460-11-11-14-LB1)
MMMPAGVSLWVEIPVALLLILSGLFTLTAAIGVVRFKTFFQRMHPPALAFSFSAWCVTLA
SIIYFSAQDARLSLHAWLIIIFLSLTVPVTTILLARTELFRRRIGNPGAGDIPPSLSHVV
PRPGEGDEARPRD