Protein Info for PS417_13500 in Pseudomonas simiae WCS417

Annotation: ATP-dependent DNA helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 751 PF00270: DEAD" amino acids 192 to 274 (83 residues), 25.2 bits, see alignment E=1.8e-09 PF06733: DEAD_2" amino acids 270 to 391 (122 residues), 55.7 bits, see alignment E=7.5e-19 PF13307: Helicase_C_2" amino acids 587 to 749 (163 residues), 134.4 bits, see alignment E=6.5e-43

Best Hits

KEGG orthology group: None (inferred from 94% identity to pfs:PFLU3138)

Predicted SEED Role

"DinG family ATP-dependent helicase CPE1197" in subsystem DNA repair, bacterial DinG and relatives

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U9N6 at UniProt or InterPro

Protein Sequence (751 amino acids)

>PS417_13500 ATP-dependent DNA helicase (Pseudomonas simiae WCS417)
MSYSVAVRALCEFTAKVGDLDLRFTPSPSAQEGIIGHRTVASRRSAHYQNEVALEGEYQQ
LKVRGRADGYDPDANRLEEVKTYRGDLDAQPANHRQLHWAQVKVYGWLMCQKLNLSHINL
ALVYFDIVGEGETVLNQRFQAAELEPFFNQQCALFLGWAQQEMAHREARNSAAQTLAFPH
AGFRPGQRSLAESVYKAVSTGRCLMAQAPTGIGKTIGTIFPLLKALAPQRLDKLFFLTAK
TPGRKLALDAAQVLHASSPDQPLRVLELVARDKACEHLDKACHGDACPLAKGFYDRLPAA
RIAAAKVRLLDQRNLRDVALAHDVCPYYLSQEMARWADLVVADYNYYFDFGAMLFGLAQL
NQWRAAVLVDEAHNLVERARSMYSASLDQYHLKTLRETAPEPLKQPLQRLNRAWNALHKD
QLAPYQAYTARPEKLLQALSLCASAMGEYFNDHPESLSGDLQRFYFEVLQFGKVAELFNE
HFIFDISKRQLNGKRSSSTLCLRNVVPAEFIRPRLTAARSSVLFSATLSPRHYYADLLGL
PADTAWIDVESPFKAEQLHVRIVDEISTRFVHRHASLEPIVELIARQYTQQPGNYLAFFS
SFDYLQQVAQLLAEKHPTITLWQQSRGMAEAERQAFLDQFTEHSQGIGFAVLGGAFGEGI
DLPGARLIGAFIATLGLPQLNPVNEQMKLRMGAIFGAGYDYTYLYPGIQKVVQAAGRVIR
SQQDQGVVMLIDDRFGEARVRQLLPRWWTVA