Protein Info for GFF265 in Xanthobacter sp. DMC5

Annotation: Cysteine--tRNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 TIGR00435: cysteine--tRNA ligase" amino acids 3 to 459 (457 residues), 472.3 bits, see alignment E=1e-145 PF01406: tRNA-synt_1e" amino acids 17 to 315 (299 residues), 377.9 bits, see alignment E=1.2e-116 PF09334: tRNA-synt_1g" amino acids 258 to 301 (44 residues), 22.9 bits, see alignment 1e-08 PF23493: CysS_C" amino acids 417 to 454 (38 residues), 31.2 bits, see alignment 5.7e-11

Best Hits

Swiss-Prot: 93% identical to SYC_XANP2: Cysteine--tRNA ligase (cysS) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K01883, cysteinyl-tRNA synthetase [EC: 6.1.1.16] (inferred from 93% identity to xau:Xaut_4717)

Predicted SEED Role

"Cysteinyl-tRNA synthetase (EC 6.1.1.16)" in subsystem Conserved gene cluster possibly involved in RNA metabolism (EC 6.1.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (462 amino acids)

>GFF265 Cysteine--tRNA ligase (Xanthobacter sp. DMC5)
MELRLYNTLTRSKDLLRPLDPANVRMYVCGPTVYDHAHIGNARPVIVFDVLFRLLRRLYG
AEQVKYVRNITDVDDKINTRAAERSISIRDLTEETYRWFREDTAALHCLPPTVEPRATEH
IEEMRTLIERLVASGHAYVAEEHVLFHVPSMPDYGRLSRRSLDEMVAGARVDVAPYKRDA
MDFVLWKPSAAGVPGWPSPCGIATPGRPGWHIECSAMSWKHLGETFDIHGGGIDLVFPHH
ENEIAQTRCAFHSGVMAQMWMHNGFLMLEGEKMSKSLGNFVTIRELLDEWPGEVLRLAML
STHYRQPINWTRQGLGFAAKTLDKWYRVIGDVEAETGDANPFETEIADRLADDLNTPSVI
AHLHHLAEVAEHEDTSSALRRRFKGAANLLGLLGDTETGWRARQKEGIALDEGVIADLIA
QRIAARKAKDFKRADQIREELAAKGIVLMDNKDGTTSWEVSR