Protein Info for GFF2641 in Methylophilus sp. DMC18

Annotation: Urease subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00193: urease, gamma subunit
  • amino acids 1 to 100 (100 residues), 135.7 bits, E=5.7e-44
• PF00547: Urease_gamma
  • amino acids 1 to 99 (99 residues), 144.3 bits, E=1.3e-46
• TIGR00192: urease, beta subunit
  • amino acids 112 to 212 (101 residues), 149.4 bits, E=3.3e-48
• PF00699: Urease_beta
  • amino acids 114 to 210 (97 residues), 144.7 bits, E=7.1e-47

Best Hits

Swiss-Prot: 62% identical to URE23_PSEU2: Urease subunit gamma/beta (ureAB) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K14048, urease subunit gamma/beta [EC: 3.5.1.5] (inferred from 64% identity to hdn:Hden_2810)

MetaCyc: 47% identical to urease subunit alpha UreA (Helicobacter pylori 26695)

Predicted SEED Role

No annotation

MetaCyc Pathways

• urea degradation II (1/1 steps found)
• superpathway of allantoin degradation in plants (1/8 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Atrazine degradation
• Purine metabolism
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.5

Use Curated BLAST to search for 3.5.1.5

Protein Sequence (233 amino acids)

>GFF2641 Urease subunit alpha (Methylophilus sp. DMC18)
MLLTPVEMERFAIFNAAQLARRRMERGLKLNHPEAIAIIADEIMEGARDGRSVAELISYG
SQILTTDDVMPGVEAMVTMIQVEPVFPDGTKLVTVHDPIRPGKLKRAPEDEIVPGEIIAA
DGDIEINAGRKQVSLKAVNTGDRPIQIGSHYHFFEANRALDFERRLSFGMHLDIPAGTAV
RFEPGESKVVTLVAFGGKAEVYGLNNLTNGSTKNEELLEVALERARQSNFKGA