Protein Info for GFF2640 in Variovorax sp. SCN45

Annotation: PKHD-type hydroxylase YbiX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13640: 2OG-FeII_Oxy_3
  • amino acids 85 to 178 (94 residues), 53.1 bits, E=5.1e-18
• PF18331: PKHD_C
  • amino acids 187 to 227 (41 residues), 61.9 bits, 4.7e-21

Best Hits

Swiss-Prot: 76% identical to Y3078_CUPMC: PKHD-type hydroxylase Rmet_3078 (Rmet_3078) from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)

KEGG orthology group: K07336, PKHD-type hydroxylase [EC: 1.14.11.-] (inferred from 76% identity to rme:Rmet_3078)

Predicted SEED Role

"Iron-uptake factor PiuC" in subsystem Transport of Iron

KEGG Metabolic Maps

• Benzoxazinone biosynthesis
• Diterpenoid biosynthesis
• Glycine, serine and threonine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.14.11.-

Use Curated BLAST to search for 1.14.11.-

Protein Sequence (228 amino acids)

>GFF2640 PKHD-type hydroxylase YbiX (Variovorax sp. SCN45)
MLVCIPGVLDRDALAAVRARLDAAGDAWVDGRVTAGHQGAPVKFNQQIDEGSAVAHECQS
IIAGALERHPTFISAALPNLLYPPMFNRYSEGMRFGLHVDGGVRIDPRTGRKLRTDLSAT
LFLSDADSYDGGELQMEDTHGMQTVKLAAGDMVLYPATSLHQVTPITRGVRVACFFWVQS
LVRDAGDRALLFDMDNAIQRLNQSGADESARRTLVGTYHNLLRKWSDT