Protein Info for PS417_13440 in Pseudomonas simiae WCS417

Annotation: amino acid permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 48 to 68 (21 residues), see Phobius details amino acids 88 to 111 (24 residues), see Phobius details amino acids 130 to 147 (18 residues), see Phobius details amino acids 155 to 175 (21 residues), see Phobius details amino acids 197 to 217 (21 residues), see Phobius details amino acids 237 to 260 (24 residues), see Phobius details amino acids 288 to 310 (23 residues), see Phobius details amino acids 339 to 358 (20 residues), see Phobius details amino acids 365 to 388 (24 residues), see Phobius details amino acids 400 to 421 (22 residues), see Phobius details amino acids 427 to 447 (21 residues), see Phobius details PF13520: AA_permease_2" amino acids 15 to 419 (405 residues), 112.3 bits, see alignment E=2.8e-36 PF00324: AA_permease" amino acids 20 to 422 (403 residues), 54.9 bits, see alignment E=6.5e-19

Best Hits

KEGG orthology group: None (inferred from 97% identity to pfs:PFLU3148)

Predicted SEED Role

"probable amino acid permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U3P5 at UniProt or InterPro

Protein Sequence (454 amino acids)

>PS417_13440 amino acid permease (Pseudomonas simiae WCS417)
MSTSPTPDGVLKPTLSVFDVVAITVSAVTPASSVFVIAPFAIQQAGSGVFLAFVMAGLLA
LMFAFCYAELGRAHNSAGGEYVYATRVFGGMAGYATFLTVLVMLLFIPPVLATGAATYLN
NALGTKFDSQTVALVIVVCSYALGILNIKLNAWITGTCLLLEVAALLVIVVIGFGNPVQP
ASVLFQPQIVENGVLHLAPWALVIGAVGIGLFSYNGYGPAVLLAEDMKCGGKGVHKAVLW
SLGLVVIIELVPITALLIGAPSLSEMISSPDPIGYLLTSHGNETLSRLVSAGIFLSVFNA
IVAIVIQIGRVVFSSGRDALWTPSINKLFTRIHPRWDSPWLATLFLAIPSALLSFSSNLA
DLTSFSVLLIMLVYLVVALSALMSRVLLRDREHPYRMPLWPLPALVAVLGAGYLLVTLVA
AASIRDIMIIIGLLALSVILYCISGRLSPVFQKL