Protein Info for GFF2635 in Pseudomonas sp. DMC3

Annotation: Enolase-phosphatase E1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 PF00702: Hydrolase" amino acids 3 to 197 (195 residues), 49.3 bits, see alignment E=8.1e-17 TIGR01691: 2,3-diketo-5-methylthio-1-phosphopentane phosphatase" amino acids 3 to 210 (208 residues), 270.4 bits, see alignment E=1.1e-84 PF13419: HAD_2" amino acids 102 to 202 (101 residues), 26.6 bits, see alignment E=6e-10 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 103 to 197 (95 residues), 25.6 bits, see alignment E=1.5e-09

Best Hits

Swiss-Prot: 92% identical to MTNC_PSEPF: Enolase-phosphatase E1 (mtnC) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K09880, enolase-phosphatase E1 [EC: 3.1.3.77] (inferred from 92% identity to pfo:Pfl01_1726)

Predicted SEED Role

"2,3-diketo-5-methylthiopentyl-1-phosphate enolase-phosphatase (EC 3.1.3.77)" in subsystem Methionine Salvage (EC 3.1.3.77)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.77

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (227 amino acids)

>GFF2635 Enolase-phosphatase E1 (Pseudomonas sp. DMC3)
VSIKAILTDIEGTTSAVSFVFDVLFPYAAEHLPEFVRQNASRADVAEQLDAVRRDSNEPQ
ADVERVVEILLSWIAEDRKATPLKALQGMVWAQGYQAGQLKGHVYPDAVEALQRWHAAGY
QLFVYSSGSIQAQKLIFGCSEAGDLTPLFSGYFDTTSGPKREAQSYRNIQQAVGVEADEI
LFLSDIVEELDAAQSAGMKTCGLAREGGELAGHVTVDSFTGIEPEAF