Protein Info for GFF2626 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Nucleoside ABC transporter, permease protein 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 32 to 52 (21 residues), see Phobius details amino acids 59 to 78 (20 residues), see Phobius details amino acids 84 to 106 (23 residues), see Phobius details amino acids 112 to 131 (20 residues), see Phobius details amino acids 151 to 170 (20 residues), see Phobius details amino acids 198 to 220 (23 residues), see Phobius details amino acids 239 to 264 (26 residues), see Phobius details amino acids 275 to 295 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 34 to 287 (254 residues), 99.7 bits, see alignment E=8.3e-33

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 41% identity to kvu:EIO_1920)

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (342 amino acids)

>GFF2626 Nucleoside ABC transporter, permease protein 1 (Hydrogenophaga sp. GW460-11-11-14-LB1)
MNSRQFLIRDLLVLFGFTGWAVALPGFGSDFVVSMALTCLMYIALSSSWALFCGTTRYLS
LATSAFFGIGAYASAILLESVSWSQAIGLGALIAAGVAIVMGAAVLHLRGTYFAVLTFGM
TELIRHAISYFEKSVTGTVGRVLMVVPERDTIYFTVLLLAVGTVALSIAIRRTRFGLAML
GIGADEQRAQTLGVNTRLVKIAGFAITAAVAGAVGAAMSVRWTYIDPHTVFNPFIGFQTV
LIALIGGAATLWGPLIAAIVFSVLAETLRLQVPQVYMMSLGLLLILSVLYLPGGLASVRT
DTFRAWRDDARAWWKDIKDDLSGETKRRKQREKDQRERSHVF