Protein Info for GFF2625 in Methylophilus sp. DMC18

Annotation: Cytochrome c oxidase subunit 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details amino acids 100 to 123 (24 residues), see Phobius details amino acids 176 to 198 (23 residues), see Phobius details amino acids 206 to 228 (23 residues), see Phobius details amino acids 247 to 271 (25 residues), see Phobius details amino acids 290 to 309 (20 residues), see Phobius details PF00510: COX3" amino acids 60 to 131 (72 residues), 40 bits, see alignment E=2.2e-14 amino acids 157 to 309 (153 residues), 169.6 bits, see alignment E=6.4e-54

Best Hits

KEGG orthology group: K02276, cytochrome c oxidase subunit III [EC: 1.9.3.1] (inferred from 79% identity to mmb:Mmol_0551)

Predicted SEED Role

"Cytochrome c oxidase polypeptide III (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (310 amino acids)

>GFF2625 Cytochrome c oxidase subunit 3 (Methylophilus sp. DMC18)
MASHSENHYFVPHGSIYPALISVGLLSMASGFVFNVTGSDTRLDGSMKNPALSYLATPGK
YMMYLGLAIVLAMMFKWLSAVVTESVTGQYKKWEDKSFRIGMIVFICSEVAFFAAFFGAL
FYMRVLSVPDLASYAPDITPYKDFLSTWPSQGPGGTVLGETYQPNTAFHPMTWSGLPLIN
TLLLLSSGATITWAHWGLIKNNRKQLIVGLFLTIALGITFLCCQAAEYHHAYTEMGLTLK
SGAYGATFFMLTGFHGFHVTIGTLMLIVIWLRSIRGHFTPEHHFGFEGVAWYWHFVDVVW
LGLYIFVYML