Protein Info for GFF2623 in Pseudomonas sp. DMC3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 transmembrane" amino acids 27 to 50 (24 residues), see Phobius details amino acids 74 to 88 (15 residues), see Phobius details amino acids 97 to 119 (23 residues), see Phobius details amino acids 137 to 168 (32 residues), see Phobius details amino acids 175 to 193 (19 residues), see Phobius details amino acids 199 to 216 (18 residues), see Phobius details amino acids 225 to 245 (21 residues), see Phobius details amino acids 363 to 382 (20 residues), see Phobius details amino acids 394 to 414 (21 residues), see Phobius details amino acids 420 to 437 (18 residues), see Phobius details amino acids 449 to 467 (19 residues), see Phobius details

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (484 amino acids)

>GFF2623 hypothetical protein (Pseudomonas sp. DMC3)
MDTGSYKKPLTSKIKIMLKAFKHHEELSAFFLTLLIIFTTQFCIGAIKFVGDANAYWYYS
SFILDLDFPKTMRGYFYPLVLATPRFIANSWPSSGYIGFYVVQALLFSYIFSTLLPYVFT
RLIGGKLSVSRRILPPLLVAIFFPGLMAYPLSDLPALCMIVASLYLALRASKQKNLASSF
LFLFLAGITAYGAYNIRTIYLFPLLILIPIIPALLLKKNSHIEKLLLTASFIAGATFASL
PQIIINFKHLNSPSPLVITDHKNTSLYANQLKWGVTIQRYETGYNSETGGIYPIYYIDPL
GERLFENANLGEGVITVPKILTAIVNHPLSFLRIYTKHFINGMDVRDPDPYTSTSSKDRN
FRSFTSLSVSVLGAFFLVLVVARSETGRNPWPQILSKVTWLVLLLLPVLAITPGAIETRF
FLPFHLIGYCAISYGFSKNLKNKFSAKEALLAIVIYLTLVLSFYNSARESVQHPNSAIKK
EYFE