Protein Info for GFF2622 in Pseudomonas sp. DMC3

Annotation: GTP cyclohydrolase 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01227: GTP_cyclohydroI
  • amino acids 4 to 180 (177 residues), 251.3 bits, E=2e-79
• TIGR00063: GTP cyclohydrolase I
  • amino acids 4 to 181 (178 residues), 248.7 bits, E=1.3e-78

Best Hits

Swiss-Prot: 95% identical to GCH12_PSESM: GTP cyclohydrolase 1 2 (folE2) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K01495, GTP cyclohydrolase I [EC: 3.5.4.16] (inferred from 95% identity to pst:PSPTO_2035)

Predicted SEED Role

"GTP cyclohydrolase I (EC 3.5.4.16) type 1" in subsystem Folate Biosynthesis or Molybdenum cofactor biosynthesis or Pterin biosynthesis or Queuosine-Archaeosine Biosynthesis (EC 3.5.4.16)

MetaCyc Pathways

• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
• tetrahydromonapterin biosynthesis (3/4 steps found)
• drosopterin and aurodrosopterin biosynthesis (5/7 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis IV (Plasmodium) (2/3 steps found)
• superpathway of chorismate metabolism (42/59 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis I (3/5 steps found)
• erythro-tetrahydrobiopterin biosynthesis I (2/4 steps found)
• threo-tetrahydrobiopterin biosynthesis (2/4 steps found)
• preQ₀ biosynthesis (2/4 steps found)

KEGG Metabolic Maps

• Folate biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.16

Use Curated BLAST to search for 3.5.4.16

Protein Sequence (181 amino acids)

>GFF2622 GTP cyclohydrolase 1 (Pseudomonas sp. DMC3)
VTLEQNYTAILGQLGEDVSREGLLDTPKRAAKAMQYLCRGYAQTLEEVTNGALFSSDNSE
MVLVKDIELYSLCEHHLLPFIGKAHVAYIPSGKVLGLSKVARIVDMYARRLQIQENLSRQ
IADAVMQVTGALGVAVVIEAKHMCMMMRGVEKQNSSMITSVMLGEFRENAATRSEFLSLI
K