Protein Info for GFF2621 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: LPS-assembly lipoprotein RlpB precursor (Rare lipoprotein B)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 177 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details PF04390: LptE" amino acids 47 to 171 (125 residues), 56.6 bits, see alignment E=2.2e-19

Best Hits

KEGG orthology group: K03643, LPS-assembly lipoprotein (inferred from 51% identity to mpt:Mpe_A0217)

Predicted SEED Role

"LPS-assembly lipoprotein RlpB precursor (Rare lipoprotein B)" in subsystem KDO2-Lipid A biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (177 amino acids)

>GFF2621 LPS-assembly lipoprotein RlpB precursor (Rare lipoprotein B) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MPTHRPSPTPIAARRRALLQLAAGAAALAGVTGCGFKLRQAPTFVFQTVRLVGGTNTPVT
AELLRALATNGLQVVYGATPADVVLTVVTDQRERIAVGQTAAGQVRELQLRTRFTFRLRT
TSDKDLIDDTELLLERDLSFSETAVLSKDAEEALLYRDMVSDAVQQVVRRLAAVKSL