Protein Info for GFF2613 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: PTS system nitrogen-specific IIA component, PtsN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00359: PTS_EIIA_2
  • amino acids 9 to 148 (140 residues), 107.8 bits, E=2.4e-35

Best Hits

Swiss-Prot: 39% identical to PTSN_KLEOX: Nitrogen regulatory protein (ptsN) from Klebsiella oxytoca

KEGG orthology group: K02806, PTS system, nitrogen regulatory IIA component [EC: 2.7.1.69] (inferred from 85% identity to aav:Aave_4557)

Predicted SEED Role

"PTS system nitrogen-specific IIA component, PtsN"

KEGG Metabolic Maps

• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Fructose and mannose metabolism
• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Starch and sucrose metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Protein Sequence (156 amino acids)

>GFF2613 PTS system nitrogen-specific IIA component, PtsN (Hydrogenophaga sp. GW460-11-11-14-LB1)
MNRLSAILPAVQVLVGVDATSKKRAFEEAGLLFETEHGLNRALITDSLFARERLGSTGLG
HGVAIPHGRIKGLKQPLAAVFQLASPIGFDAPDEQPVQFMIFLLVPEVATQKHLEILSEI
AEMLSDSALREQMKTSTDAAELHKLITSWQSAHAAA