Protein Info for GFF2610 in Variovorax sp. SCN45

Annotation: Fructose ABC transporter, permease component FrcC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details amino acids 37 to 82 (46 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 121 to 140 (20 residues), see Phobius details amino acids 166 to 184 (19 residues), see Phobius details amino acids 213 to 234 (22 residues), see Phobius details amino acids 254 to 281 (28 residues), see Phobius details amino acids 289 to 310 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 40 to 308 (269 residues), 134.4 bits, see alignment E=2.2e-43

Best Hits

KEGG orthology group: K10553, fructose transport system permease protein (inferred from 96% identity to vap:Vapar_3353)

Predicted SEED Role

"Fructose ABC transporter, permease component FrcC" in subsystem Fructose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (319 amino acids)

>GFF2610 Fructose ABC transporter, permease component FrcC (Variovorax sp. SCN45)
MAKSPTHHIPWGALGPWLALLGACIFFATQSDRFLTGGNLSLILQQVMVVGVIAIGQTLI
ILTAGIDLSCGMVMALGGIIMSKFATELGLPAPVAILCGIGVTTLFGLLNGLLVTRIKLP
PFIVTLGTLNIAFAITQLYSSSQTITDLPGGLTGLGTTFSIGNAEVAWGAVLMLVLYGLA
WFVLRETAAGRHIYAVGNNAEATRLVGIPTQRVLLGVYVAAGVLYGIASLLSVARTGVGD
PNAGQTENLDAITAVVLGGTSLFGGRGIVLGSLIGVLIVGVFRNGLTLMGVSSIYQVLVT
GVLVILAVTADQLSRRGAR