Protein Info for GFF2605 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Putative nucleoside triphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 PF03437: BtpA" amino acids 10 to 265 (256 residues), 352.3 bits, see alignment E=8e-110 TIGR00259: membrane complex biogenesis protein, BtpA family" amino acids 11 to 267 (257 residues), 386.9 bits, see alignment E=2.2e-120

Best Hits

Swiss-Prot: 93% identical to SGCQ_ECOLI: Putative sgc region protein SgcQ (sgcQ) from Escherichia coli (strain K12)

KEGG orthology group: K06971, (no description) (inferred from 99% identity to spt:SPA1254)

Predicted SEED Role

"Putative nucleoside triphosphatase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (268 amino acids)

>GFF2605 Putative nucleoside triphosphatase (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSWLKEVIGTEKAVIAMCHLRALPGDPGFDTRKGMNWVIDRAHDDLMALQNGGVDAVMFS
NEFSLPYLTKVRPETTAAMARIIGQLMSEIRVPFGVNVLWDPVASFDLAMATDAKFIREI
FTGAYASDFGVWDTNVGETIRHQHRIGAGHVKTLFNIVPEAAVYLGNRDVCSIAKSTVFN
NNPDALCVSGLTAGARTDSAILKRVKETVPDTVVLANTGVCLENVEEQLCIADGCVTATT
FKKDGVFANFVDQARVAKFMEKVRHIRQ