Protein Info for GFF2604 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Aspartate 1-decarboxylase (EC 4.1.1.11)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 116 TIGR00223: aspartate 1-decarboxylase" amino acids 1 to 114 (114 residues), 158.7 bits, see alignment E=3.1e-51 PF02261: Asp_decarbox" amino acids 1 to 110 (110 residues), 156.8 bits, see alignment E=9.5e-51

Best Hits

Swiss-Prot: 82% identical to PAND_RALPJ: Aspartate 1-decarboxylase (panD) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K01579, aspartate 1-decarboxylase [EC: 4.1.1.11] (inferred from 82% identity to rpf:Rpic12D_2560)

MetaCyc: 51% identical to aspartate 1-decarboxylase proenzyme (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Aspartate 1-decarboxylase (EC 4.1.1.11)" in subsystem Coenzyme A Biosynthesis (EC 4.1.1.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.11

Use Curated BLAST to search for 4.1.1.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (116 amino acids)

>GFF2604 Aspartate 1-decarboxylase (EC 4.1.1.11) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MLRAKLHRATVTEADLHYEGSCGIDEDLMDAADMREYEKIELYNVNNGERFSTYIIKAAR
GSGAISLNGAAARKAHVGDLLIICTYSPVDDAAVPQWKPRVVLLGEGNRINEIKKT