Protein Info for GFF2595 in Variovorax sp. SCN45

Annotation: Beta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00561: Abhydrolase_1
  • amino acids 13 to 116 (104 residues), 63.7 bits, E=3.3e-21
• PF12146: Hydrolase_4
  • amino acids 14 to 225 (212 residues), 63.2 bits, E=3.6e-21
• PF12697: Abhydrolase_6
  • amino acids 15 to 245 (231 residues), 58.9 bits, E=1.8e-19

Best Hits

KEGG orthology group: K01055, 3-oxoadipate enol-lactonase [EC: 3.1.1.24] (inferred from 87% identity to vap:Vapar_3321)

Predicted SEED Role

"Beta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24)" in subsystem Catechol branch of beta-ketoadipate pathway or Chloroaromatic degradation pathway or Protocatechuate branch of beta-ketoadipate pathway (EC 3.1.1.24)

MetaCyc Pathways

• aromatic compounds degradation via β-ketoadipate (8/9 steps found)
• protocatechuate degradation II (ortho-cleavage pathway) (4/4 steps found)
• superpathway of salicylate degradation (6/7 steps found)
• catechol degradation III (ortho-cleavage pathway) (5/6 steps found)
• catechol degradation to β-ketoadipate (3/4 steps found)
• toluene degradation III (aerobic) (via p-cresol) (7/11 steps found)
• 4-methylcatechol degradation (ortho cleavage) (3/7 steps found)
• mandelate degradation to acetyl-CoA (9/18 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (21/35 steps found)
• superpathway of aerobic toluene degradation (12/30 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.24

Use Curated BLAST to search for 3.1.1.24

Protein Sequence (254 amino acids)

>GFF2595 Beta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24) (Variovorax sp. SCN45)
MTRLNVVREGDGPIVVLSHALGCDLSMWDGVAAQLARAHTVIRYDHRNHGASEVVPGPLR
IETLAQDAAELIQREAGGEPVHFVGLSMGGMTAQALAVRHPELLKTVVIANSSAHYPDQA
PWRARAETVNAQGVAAIAPGAVSRWLTPDFVTTSEGAAAAKALHDVLVRTDPQAYIASCN
AVAAIDFRESNHRIAVPTLVIGGLRDEATPLAMSQAIAGAIPNARLATIDAAHVSAVERP
VEFAQLLIDFWRSL