Protein Info for PS417_13210 in Pseudomonas simiae WCS417

Annotation: enantio-pyochelin biosynthetic protein PchC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 PF00975: Thioesterase" amino acids 21 to 240 (220 residues), 156.5 bits, see alignment E=1.3e-49 PF12697: Abhydrolase_6" amino acids 26 to 236 (211 residues), 35 bits, see alignment E=2.3e-12

Best Hits

KEGG orthology group: K12242, pyochelin biosynthetic protein PchC (inferred from 51% identity to bch:Bcen2424_5001)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U6H5 at UniProt or InterPro

Protein Sequence (252 amino acids)

>PS417_13210 enantio-pyochelin biosynthetic protein PchC (Pseudomonas simiae WCS417)
MNGAASPWLRVLRESELARARLVCLAHAGGSASFFRPWLAHLPGDIDLLAVQYPGREERF
NETHIPCLESLAMHIAAALQTLPARPLLLFGHSMGAALAYAVGVRLQAAGCGATHVFVSG
HAPAHRQPPSDLHRQDDATLIADILRQDADAAGLWANPQLRALFLPTLRSDYQAIETWRP
KQLARLTAPLDVLLARDDAEVSLEQARDWADLSHHTPDIRLFEGDHFYLKHQPRPVIHHL
LQRTAYLQGDSV