Protein Info for PS417_13205 in Pseudomonas simiae WCS417
Annotation: isochorismate-pyruvate lyase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 66% identical to PCHB_PSEAE: Isochorismate pyruvate lyase (pchB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
KEGG orthology group: K04782, isochorismate pyruvate-lyase [EC: 4.1.3.-] (inferred from 70% identity to bcj:BCAM2234)MetaCyc: 66% identical to isochorismate pyruvate lyase (Pseudomonas aeruginosa)
RXN-1981 [EC: 4.2.99.21]
Predicted SEED Role
No annotation
MetaCyc Pathways
- salicylate biosynthesis I (2/2 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of plant hormones
- Pyruvate metabolism
Isozymes
Compare fitness of predicted isozymes for: 4.1.3.-
Use Curated BLAST to search for 4.1.3.- or 4.2.99.21
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1N7TZB0 at UniProt or InterPro
Protein Sequence (102 amino acids)
>PS417_13205 isochorismate-pyruvate lyase (Pseudomonas simiae WCS417) MKTPEHCTGLSDIRQAIDSLDQQIIDALGLRMQYVKAASAFKPDQASIAAPERVAAMLPQ RRQWAQAVGLDGEFIEGLFNQIIHWYIAEQTAFWLQKKSKVV