Protein Info for GFF2586 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: FIG039061: hypothetical protein related to heme utilization

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 133 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 40 to 60 (21 residues), see Phobius details amino acids 82 to 100 (19 residues), see Phobius details amino acids 106 to 125 (20 residues), see Phobius details PF04304: DUF454" amino acids 12 to 127 (116 residues), 134.3 bits, see alignment E=1e-43

Best Hits

Swiss-Prot: 44% identical to YBAN_ECOLI: Inner membrane protein YbaN (ybaN) from Escherichia coli (strain K12)

KEGG orthology group: K09790, hypothetical protein (inferred from 60% identity to mms:mma_3498)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (133 amino acids)

>GFF2586 FIG039061: hypothetical protein related to heme utilization (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSSTPSSSRTVRWLLWLAGTVSLALGLIGVVLPGLPTTPFVLLAAACYAKASPRLHAWLL
NHRFLGPMVRDWEQHRSLTRRTKTVAIGSMVVMVGLSAWGFRHQPWVLAALLAAAAIGLI
VVARIPTRERPTS