Protein Info for GFF2583 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Ferric iron ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 576 transmembrane" amino acids 22 to 44 (23 residues), see Phobius details amino acids 77 to 101 (25 residues), see Phobius details amino acids 110 to 135 (26 residues), see Phobius details amino acids 158 to 182 (25 residues), see Phobius details amino acids 203 to 225 (23 residues), see Phobius details amino acids 260 to 279 (20 residues), see Phobius details amino acids 309 to 334 (26 residues), see Phobius details amino acids 366 to 389 (24 residues), see Phobius details amino acids 401 to 421 (21 residues), see Phobius details amino acids 428 to 447 (20 residues), see Phobius details amino acids 490 to 516 (27 residues), see Phobius details amino acids 539 to 559 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 93 to 280 (188 residues), 49.5 bits, see alignment E=2.1e-17 amino acids 378 to 566 (189 residues), 55.1 bits, see alignment E=4.3e-19

Best Hits

KEGG orthology group: K02011, iron(III) transport system permease protein (inferred from 80% identity to del:DelCs14_2054)

Predicted SEED Role

"Ferric iron ABC transporter, permease protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (576 amino acids)

>GFF2583 Ferric iron ABC transporter, permease protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSAVLTGSDVPAPRRLRPPTVWGHWLLAGLVFAFLGLFLLLPIAEVIYTAFVTETGAPTL
GHFSNFFGQSLLRESLINSLVVALASVFFASVIAIPLAYLTVRFEFRGALLIQTLGVLPL
IMPPFVGAVALQLIFGRSGSVNLLLNDWFGFTVPLMDGLVGVTFVESIHYFPFILLNLVA
AMRNIDGAMEESAQNLGAKGWRLFWRIIFPLSLPGYLAGAALVFVKVFDDLGTPLVMGVT
NMLAPQAYLRITSVGIEDPLGYVISVIMIVLSILALWMASRVMKGKDYSTLQKGGNSLQR
RPLRGWASVMAYAWVGFVLLVTLAPHIGILLMSFSKVWSFSVLPDSYTLEHYATIFTDSK
LMVVNTLKYCLMAASLDVVLGTLIAYLIFRTELPARRWLDYIASIALAIPGLVLAIGYLR
MFKGVDIPFTDTPVISTWVLIMIAYAVRRLPYALRSCMAALQQVHISLEEAGQSLGAGKV
STVRRIMVPLMMGGILAGFVTSFITAAVELSATILLTSAQSQAPMSYGIYLYMQSIAGRG
PGAALGVVAVVVVAIGTYLSHRVVEKSRAPDRAAQP