Protein Info for GFF2582 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Ferric iron ABC transporter, iron-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF01547: SBP_bac_1" amino acids 35 to 282 (248 residues), 54.2 bits, see alignment E=3.6e-18 PF13531: SBP_bac_11" amino acids 36 to 284 (249 residues), 46.4 bits, see alignment E=6.6e-16 PF13343: SBP_bac_6" amino acids 77 to 307 (231 residues), 86.2 bits, see alignment E=3.8e-28

Best Hits

KEGG orthology group: None (inferred from 73% identity to adk:Alide2_3437)

Predicted SEED Role

"Ferric iron ABC transporter, iron-binding protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (444 amino acids)

>GFF2582 Ferric iron ABC transporter, iron-binding protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MARQTAALKVAVLSLVTAWSAAHAGTVSVLTSFPKELTEAYKKAFEAANPGIKIEILNKN
TTASIAYIKELAVGQRPDVMWASAPDAFEVLARDKLLQAAPEVKNAQVPAKVGNYPINDP
NGLYYGQALAGYGLMWNTRYMQANKVPAPREWADLTKPAYFGHVAISSPSRSGTTHLTVE
TILQGEGWEKGWTQMLQIAGNCAAVTDRSFAVPDGVNNGQYGVGMVIDFFGLAGKYSGYP
VEFHYPSVTAVVPANIALISGGKNADEAKKFIAYTLSREGQELLFDPKISRLPVLPNASF
GNKAPAGYPDAQDIAKRAKVQFNTDLSSNRYQVVVSLFDQMVTFRLKELQAATRAIHEAD
RKLHAKPNAHGSELLRQARSFAYSSLVPESMVKDEKFLNLFRQNKRDVEVAKQLTGLEEL
WSSKAKANYERARDLANQAGALAK