Protein Info for GFF2581 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Putative acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 PF13302: Acetyltransf_3" amino acids 2 to 137 (136 residues), 43.3 bits, see alignment E=1.8e-14 PF13420: Acetyltransf_4" amino acids 3 to 155 (153 residues), 48.6 bits, see alignment E=2.9e-16 PF00583: Acetyltransf_1" amino acids 19 to 136 (118 residues), 70.7 bits, see alignment E=4e-23 PF13673: Acetyltransf_10" amino acids 50 to 141 (92 residues), 40.2 bits, see alignment E=9.6e-14 PF13508: Acetyltransf_7" amino acids 53 to 137 (85 residues), 46.2 bits, see alignment E=1.5e-15 PF08445: FR47" amino acids 84 to 139 (56 residues), 36.2 bits, see alignment E=1.5e-12

Best Hits

Swiss-Prot: 100% identical to MDDA_SALTY: L-methionine sulfoximine/L-methionine sulfone acetyltransferase (yncA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03823, phosphinothricin acetyltransferase [EC: 2.3.1.183] (inferred from 99% identity to sei:SPC_2145)

MetaCyc: 87% identical to L-amino acid N-acyltransferase (Escherichia coli K-12 substr. MG1655)
Amino-acid N-acetyltransferase. [EC: 2.3.1.1]

Predicted SEED Role

"Putative acetyltransferase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.1

Use Curated BLAST to search for 2.3.1.1 or 2.3.1.183

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (171 amino acids)

>GFF2581 Putative acetyltransferase (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MTIRFADKADCAAITEIYNHAVLHTAAIWNDRTVDTDNRLAWYEARQLLGYPVLVSEENG
VVTGYASFGDWRSFDGFRYTVEHSVYVHPAHQGKGLGRKLLSRLIDEARRCGKHVMVAGI
ESQNAASIRLHHSLGFTVTAQMPQVGVKFGRWLDLTFMQLQLDEHAAPDAC