Protein Info for GFF258 in Xanthobacter sp. DMC5

Annotation: tRNA dimethylallyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 TIGR00174: tRNA dimethylallyltransferase" amino acids 3 to 280 (278 residues), 243.2 bits, see alignment E=1.7e-76 PF01745: IPT" amino acids 4 to 53 (50 residues), 31.6 bits, see alignment 1.2e-11 PF01715: IPPT" amino acids 35 to 279 (245 residues), 257.7 bits, see alignment E=1.2e-80

Best Hits

Swiss-Prot: 80% identical to MIAA_XANP2: tRNA dimethylallyltransferase (miaA) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K00791, tRNA dimethylallyltransferase [EC: 2.5.1.75] (inferred from 80% identity to xau:Xaut_1659)

Predicted SEED Role

"tRNA dimethylallyltransferase (EC 2.5.1.75)" (EC 2.5.1.75)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.75

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (301 amino acids)

>GFF258 tRNA dimethylallyltransferase (Xanthobacter sp. DMC5)
LAVLIAGPTASGKSARALAVAERTGGIVLNADSMQVYGDLHVLTARPTVAEMAEVPHGLY
GHVDADMDYSVGRWLEDAKRALAAARAVGRLPVFVGGTGLYFRALTQGLAEIPAIPEAVR
AEVRGAAEALDSPDLHARLAARDPESAARLKVNDRQRVLRALEVIHATGRSLTDWQRDAQ
PPVLDAAGCAKIVLEVDRDLLRQRIDARFEAMMAAGALEEVRRLAARNLAPDRTVLKAHG
APALTRYLKGEMTLAEAVAEGQSDTRRYAKRQATFFRHQMPDWARATPEQALGVVMGMLG
N