Protein Info for GFF258 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Sulfite dehydrogenase cytochrome subunit SoxD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF13442: Cytochrome_CBB3" amino acids 60 to 154 (95 residues), 33.3 bits, see alignment E=4.9e-12 amino acids 272 to 350 (79 residues), 22.3 bits, see alignment E=1.4e-08 PF00034: Cytochrom_C" amino acids 60 to 157 (98 residues), 29 bits, see alignment E=2.3e-10 amino acids 275 to 352 (78 residues), 26.7 bits, see alignment E=1.2e-09

Best Hits

KEGG orthology group: None (inferred from 58% identity to har:HEAR1189)

Predicted SEED Role

"Sulfite dehydrogenase cytochrome subunit SoxD" in subsystem Sulfur oxidation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (355 amino acids)

>GFF258 Sulfite dehydrogenase cytochrome subunit SoxD (Hydrogenophaga sp. GW460-11-11-14-LB1)
MKPFLKTTILLAAALAAGTALAQGKPWHELGRDATQAEVKAWDIDVRPDFKGLPKGAGSV
ALGEQVWEAQCASCHGSFGESNEVFTPIVGGTTKADIERGRVKNLEPGSIFPQKTTMMKV
ATLSTLWDYINRAMPWNAPKTLKTDEVYAVTAYLLSLAEVVPADFTLSDQNIAEVQKRMP
NRNGMVFHEPLWKLEGKGDVKNVACMKDCPVESTIRSSLPDFARDAHGNIQEQNRVIGPV
RGADTTKPPPKGPVGSGPAPAAVVVAAAPAVKDPKALLGANSCTACHGMTNKIVGPGFTE
ILAKHKGKADLEAYLTGKIQGGSSGVYGAVPMPPQPQLSEADARSIARWIASGAK