Protein Info for GFF2578 in Variovorax sp. SCN45

Annotation: Pantoate--beta-alanine ligase (EC 6.3.2.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 PF02569: Pantoate_ligase" amino acids 3 to 272 (270 residues), 318.7 bits, see alignment E=1.3e-99 TIGR00018: pantoate--beta-alanine ligase" amino acids 3 to 274 (272 residues), 282.8 bits, see alignment E=1.1e-88

Best Hits

Swiss-Prot: 89% identical to PANC_VARPS: Pantothenate synthetase (panC) from Variovorax paradoxus (strain S110)

KEGG orthology group: K01918, pantoate--beta-alanine ligase [EC: 6.3.2.1] (inferred from 89% identity to vap:Vapar_4094)

MetaCyc: 48% identical to pantothenate synthetase (Escherichia coli K-12 substr. MG1655)
Pantoate--beta-alanine ligase. [EC: 6.3.2.1]

Predicted SEED Role

"Pantoate--beta-alanine ligase (EC 6.3.2.1)" in subsystem Coenzyme A Biosynthesis (EC 6.3.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (280 amino acids)

>GFF2578 Pantoate--beta-alanine ligase (EC 6.3.2.1) (Variovorax sp. SCN45)
MYIAHTIEELRGRLSASQRPAFVPTMGNLHDGHIALVKQARPLGDVTVASIFVNRLQFLP
HEDFDTYPRTWDSDCEKLRAAGCDVLFAPTEKVLYPEPQTCKVHPDPALADILEGHFRPG
FFIGVCTVVMKLFQCVQPRVAVFGKKDYQQLMMIRHMVRQFALPIEIVGGETFRADDGLA
LSSRNGYLSKDERAEAVQLSRALRAMAEAVREGERDLAAIEARAMQSLAQRGWQPDYLVL
RRRTDLQAPSAGEPLVALAAARLGSTRLIDNLEIEAFATP