Protein Info for GFF2576 in Variovorax sp. SCN45

Annotation: 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 120 PF01242: PTPS" amino acids 4 to 116 (113 residues), 104.5 bits, see alignment E=1.9e-34

Best Hits

Swiss-Prot: 39% identical to QUED_ECOLI: 6-carboxy-5,6,7,8-tetrahydropterin synthase (queD) from Escherichia coli (strain K12)

KEGG orthology group: K01737, 6-pyruvoyl tetrahydrobiopterin synthase [EC: 4.2.3.12] (inferred from 94% identity to vpe:Varpa_4763)

MetaCyc: 39% identical to 6-carboxy-5,6,7,8-tetrahydropterin synthase (Escherichia coli K-12 substr. MG1655)
RXN0-5507 [EC: 4.1.2.50]

Predicted SEED Role

"6-carboxytetrahydropterin synthase (EC 4.1.2.50) @ Queuosine biosynthesis QueD, PTPS-I" (EC 4.1.2.50)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.50 or 4.2.3.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (120 amino acids)

>GFF2576 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Variovorax sp. SCN45)
MRFTISQRFFFDAAHTLKREIEVEGSRRIHGHTYHAEVWLAGERDPVTGMVIDLGLLRRR
LEDVREQLDHHLLDDVPGLHPPTLENLCVFIADALPDLRASLARVRVWREALGDSCTVDF