Protein Info for GFF2571 in Xanthobacter sp. DMC5

Annotation: Efflux pump periplasmic linker BepF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 41 to 381 (341 residues), 262.7 bits, see alignment E=1.9e-82 PF25917: BSH_RND" amino acids 65 to 207 (143 residues), 31.3 bits, see alignment E=3.7e-11 PF25876: HH_MFP_RND" amino acids 106 to 175 (70 residues), 40.3 bits, see alignment E=7.8e-14 PF25944: Beta-barrel_RND" amino acids 212 to 306 (95 residues), 51.9 bits, see alignment E=2e-17 PF25954: Beta-barrel_RND_2" amino acids 254 to 303 (50 residues), 24.8 bits, see alignment 5.3e-09 PF25967: RND-MFP_C" amino acids 312 to 372 (61 residues), 33 bits, see alignment E=1.1e-11

Best Hits

KEGG orthology group: None (inferred from 82% identity to xau:Xaut_0513)

Predicted SEED Role

"RND efflux system, membrane fusion protein CmeA" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (438 amino acids)

>GFF2571 Efflux pump periplasmic linker BepF (Xanthobacter sp. DMC5)
MVGGIRVSGRLGCASVALGAAFLLSACEEKNTYVPPPPPKVTVATVLEQPITRFLELTGN
TAAINSVDLNARVQGFLTNINYKDGAFAKKGTTLFVIEQDTYIAQVDQAKATLAANQASQ
VQAEAEFNRQNQLAKQDFASQAALDQARAKRDSAVAQVANAEASLQLAQINLGYTQVNAP
FDGAVTAHLQDVGALVGYSGPTKLATIVQLNPIWVWFTLSEQEVLRIKEQLAKQGRSLTS
LTRDLPDIPIEIGLQTETGYPHAGRIDYIAPQVDPNLGTLTVRGIFQNDDFVLLPGLFAR
VRVPLGQPAPTILVPDSAVSYNQLGPYVLTVSSDNVVGQTQITLGQLQADGLRAVLSGLK
TTDRVIINGMQRAVPGSKIDVEVGKIVAIAPPVDDGTKPLPKPAGVAPAGAPARAIPSVP
PTPNAPATPGATPATPKN